Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMCO4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | TMCO4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16890720
![]() |
Novus Biologicals
NBP16890720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP168907
![]() |
Novus Biologicals
NBP168907 |
100 μL |
Each for $487.50
|
|
|||||
Description
TMCO4 Polyclonal specifically detects TMCO4 in Human samples. It is validated for Western Blot.Specifications
TMCO4 | |
Polyclonal | |
Rabbit | |
Q5TGY1 | |
255104 | |
Synthetic peptides corresponding to TMCO4 (transmembrane and coiled-coil domains 4) The peptide sequence was selected from the C terminal of TMCO4. Peptide sequence WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686C23231, RP5-1056L3.6, transmembrane and coiled-coil domain-containing protein 4, transmembrane and coiled-coil domains 4 | |
TMCO4 | |
IgG | |
68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title