Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMCO6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TMCO6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157660
|
Novus Biologicals
NBP157660 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15766020
|
Novus Biologicals
NBP15766020UL |
20 μL | N/A | N/A | N/A | ||||
Description
TMCO6 Polyclonal specifically detects TMCO6 in Human samples. It is validated for Western Blot.Specifications
| TMCO6 | |
| Polyclonal | |
| Rabbit | |
| Q96DC7 | |
| 55374 | |
| Synthetic peptides corresponding to TMCO6(transmembrane and coiled-coil domains 6) The peptide sequence was selected from the N terminal of TMCO6. Peptide sequence LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ39769, PRO1580, transmembrane and coiled-coil domain-containing protein 6, transmembrane and coiled-coil domains 6 | |
| TMCO6 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title