Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMED1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB124897 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB124897 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB124897 Supplier Novus Biologicals Supplier No. NBP309998100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TMED1 Polyclonal specifically detects TMED1 in Mouse samples. It is validated for Western Blot, Aggregation.

Specifications

Antigen TMED1
Applications Western Blot, Aggregation
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Aggregation
Formulation PBS buffer, 2% sucrose
Gene Alias Il1rl1l, IL1RL1LGIL1RL1-binding protein, interleukin 1 receptor-like 1 ligand, Interleukin-1 receptor-like 1 ligand, MGC1270, Putative T1/ST2 receptor-binding protein, ST2L, T1/ST2 receptor binding protein, transmembrane emp24 domain containing 1, transmembrane emp24 domain-containing protein 1, transmembrane emp24 protein transport domain containing 1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TMED1 (NP_034874.2). Peptide sequence MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAAN
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11018
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.