Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TMEM126B Antibody, Novus Biologicals™

TMEM126B Antibody, Novus Biologicals™
SDP

Catalog No. NBP15976820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15976820 20 μL
NBP159768 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15976820 Supplier Novus Biologicals Supplier No. NBP15976820UL

Description

Rabbit Polyclonal Antibody

TMEM126B Polyclonal specifically detects TMEM126B in Human samples. It is validated for Western Blot.

Specifications

Antigen TMEM126B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IUX1
Gene Alias HT007, MGC111203, transmembrane protein 126B
Gene Symbols TMEM126B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the N terminal of TMEM126B. Peptide sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 55863
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.