Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM126B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | TMEM126B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15976820
|
Novus Biologicals
NBP15976820UL |
20 μL |
Each for $152.22
|
|
NBP159768
|
Novus Biologicals
NBP159768 |
100 μL |
Each for $436.00
|
|
Description
TMEM126B Polyclonal specifically detects TMEM126B in Human samples. It is validated for Western Blot.Specifications
TMEM126B | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
Q8IUX1 | |
55863 | |
Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the N terminal of TMEM126B. Peptide sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HT007, MGC111203, transmembrane protein 126B | |
TMEM126B | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title