Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM126B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen TMEM126B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15976820
View Documents
Novus Biologicals
NBP15976820UL
20 μL
Each for $152.22
Add to cart
 
NBP159768
View Documents
Novus Biologicals
NBP159768
100 μL
Each for $436.00
Add to cart
 
Description

Description

TMEM126B Polyclonal specifically detects TMEM126B in Human samples. It is validated for Western Blot.
Specifications

Specifications

TMEM126B
Polyclonal
Rabbit
Stem Cell Markers
Q8IUX1
55863
Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the N terminal of TMEM126B. Peptide sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
HT007, MGC111203, transmembrane protein 126B
TMEM126B
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit