TMEM176A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160015

Catalog No. NBP160015

Description

TMEM176A Polyclonal specifically detects TMEM176A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TMEM176A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GS188, HCA112Hepatocellular carcinoma-associated antigen 112, likley ortholog of mouse GS188, transmembrane protein 176A
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55365
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96HP8
• Gene Symbols: TMEM176A
• Immunogen: Synthetic peptides corresponding to TMEM176A(transmembrane protein 176A) The peptide sequence was selected from the middle region of TMEM176A. Peptide sequence GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Equine
• Isotype: IgG