Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM184B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179196
Description
TMEM184B Polyclonal specifically detects TMEM184B in Rat samples. It is validated for Western Blot.Specifications
TMEM184B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp586A1024, DKFZp686F07174, DKFZp686N1150, FM08, PSEC0108, transmembrane protein 184B | |
Rabbit | |
Affinity purified | |
RUO | |
25829 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_001166841 | |
TMEM184B | |
The immunogen for this antibody is Tmem184b. Peptide sequence STVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATREL. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Equine: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Xenopus: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction