Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM184B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | TMEM184B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17919620
|
Novus Biologicals
NBP17919620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179196
|
Novus Biologicals
NBP179196 |
100 μL |
Each for $487.50
|
|
|||||
Description
TMEM184B Polyclonal specifically detects TMEM184B in Rat samples. It is validated for Western Blot.Specifications
| TMEM184B | |
| Polyclonal | |
| Rabbit | |
| NP_001166841 | |
| 25829 | |
| The immunogen for this antibody is Tmem184b. Peptide sequence STVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATREL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp586A1024, DKFZp686F07174, DKFZp686N1150, FM08, PSEC0108, transmembrane protein 184B | |
| TMEM184B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title