TMEM55B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21345325UL

Catalog No. NB405008

Description

TMEM55B Polyclonal specifically detects TMEM55B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TMEM55B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: C14orf9, chromosome 14 open reading frame 9, DKFZp434M0519, EC 3.1.3.78, MGC26684, PtdIns-4,5-P(2) 4-phosphatase type I, PtdIns-4,5-P2 4-Ptase I, transmembrane protein 55B, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90809
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TMEM55B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only