TMEM63A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169249

Catalog No. NBP169249

Description

TMEM63A Polyclonal specifically detects TMEM63A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TMEM63A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0792KIAA0489, transmembrane protein 63A
• Host Species: Rabbit
• Molecular Weight of Antigen: 89 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%; Mouse: 86%; Guinea pig: 86%; Yeast: 83%.
• Target Species: Human, Mouse, Rat, Guinea Pig, Rabbit, Yeast
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O94886
• Gene Symbols: TMEM63A
• Immunogen: Synthetic peptides corresponding to TMEM63A(transmembrane protein 63A) The peptide sequence was selected from the N terminal of TMEM63A. Peptide sequence MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9725
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only