Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM79 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15983220UL
Description
TMEM79 Polyclonal specifically detects TMEM79 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
TMEM79 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence | |
Q9BSE2 | |
TMEM79 | |
Synthetic peptide directed towards the C terminal of human TMEM79 (NP_115699). Peptide sequence LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG. | |
Affinity Purified | |
RUO | |
84283 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ16057, FLJ32254, MGC13102, transmembrane protein 79 | |
Rabbit | |
43 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction