Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM79 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen	TMEM79
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159832 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159832	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP15983220 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15983220UL	20 μL	N/A		N/A	N/A

Description

TMEM79 Polyclonal specifically detects TMEM79 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	TMEM79
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9BSE2
Gene ID (Entrez)	84283
Immunogen	Synthetic peptide directed towards the C terminal of human TMEM79 (NP_115699). Peptide sequence LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG.
Primary or Secondary	Primary

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	FLJ16057, FLJ32254, MGC13102, transmembrane protein 79
Gene Symbols	TMEM79
Isotype	IgG
Molecular Weight of Antigen	43 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TMEM79 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents