Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMPRSS11A Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169720 100 μg
NB169721 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB169720 Supplier Novus Biologicals Supplier No. NBP317322100UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TMPRSS11A Polyclonal antibody specifically detects TMPRSS11A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen TMPRSS11A
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Airway Trypsin-Like Protease 1, EC 3.4.21, EC 3.4.21., ECRG1, Epidermal Type II Transmembrane Serine Protease, Epidermal Type-II Transmembrane Serine Protease, Esophageal Cancer-Susceptibility Gene 1 Protein, HATL1, HESP, Transmembrane Protease Serine 11A, Transmembrane Protease, Serine 11A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis, Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 339967
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.