Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMPRSS11A Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$343.50 - $573.00

Specifications

Antigen TMPRSS11A
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB169721
SDP
View Documents
Novus Biologicals
NBP31732225UL
25 μg
Each for $343.50
Only null left
Add to Cart
 
NB169720
SDP
View Documents
Novus Biologicals
NBP317322100UL
100 μg
Each for $573.00
Only null left
Add to Cart
 
Description

Description

TMPRSS11A Polyclonal antibody specifically detects TMPRSS11A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

TMPRSS11A
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
Apoptosis, Cell Biology
PBS, pH 7.2, 40% glycerol
339967
IgG
Affinity purified
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Polyclonal
Purified
RUO
Human
Airway Trypsin-Like Protease 1, EC 3.4.21, EC 3.4.21., ECRG1, Epidermal Type II Transmembrane Serine Protease, Epidermal Type-II Transmembrane Serine Protease, Esophageal Cancer-Susceptibility Gene 1 Protein, HATL1, HESP, Transmembrane Protease Serine 11A, Transmembrane Protease, Serine 11A
This antibody was developed against Recombinant Protein corresponding to amino acids: FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.