Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TMPRSS2 Antibody, Novus Biologicals™

TMPRSS2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP238263 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238263 0.1 mL
NB404676 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238263 Supplier Novus Biologicals Supplier No. NBP238263
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

TMPRSS2 Polyclonal specifically detects TMPRSS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen TMPRSS2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O15393
Gene Alias EC 3.4.21, FLJ41954, NP_001128571.1, NP_001369649.1, NP_005647.3, PP9284, PRSS10, Serine protease 10, TMPRSS2, transmembrane protease serine 2, transmembrane protease, serine 2
Gene Symbols TMPRSS2
Host Species Rabbit
Immunogen This TMPRSS2 Antibody was developed against a recombinant protein corresponding to amino acids: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Molecular Weight of Antigen 53.9 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Neuroscience, Prostate Cancer, Virology Bacteria and Parasites
Primary or Secondary Primary
Gene ID (Entrez) 7113
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.