TMPRSS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP238263

Catalog No. NBP238263

Description

TMPRSS2 Polyclonal specifically detects TMPRSS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TMPRSS2
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: O15393
• Gene Symbols: TMPRSS2
• Immunogen: This TMPRSS2 Antibody was developed against a recombinant protein corresponding to amino acids: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.4.21, FLJ41954, NP_001128571.1, NP_001369649.1, NP_005647.3, PP9284, PRSS10, Serine protease 10, TMPRSS2, transmembrane protease serine 2, transmembrane protease, serine 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 53.9 kDa
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cell Biology, Neuroscience, Prostate Cancer, Virology Bacteria and Parasites
• Gene ID (Entrez): 7113
• Target Species: Human
• Isotype: IgG