Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMPRSS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$393.50 - $670.50

Specifications

Antigen	TMPRSS2
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP238263 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP238263	0.1 mL	Each for $670.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB404676 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23826325UL	25 μL	Each for $393.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TMPRSS2 Polyclonal specifically detects TMPRSS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	TMPRSS2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cancer, Cell Biology, Neuroscience, Prostate Cancer, Virology Bacteria and Parasites
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	EC 3.4.21, FLJ41954, NP_001128571.1, NP_001369649.1, NP_005647.3, PP9284, PRSS10, Serine protease 10, TMPRSS2, transmembrane protease serine 2, transmembrane protease, serine 2
Gene Symbols	TMPRSS2
Isotype	IgG
Purification Method	Affinity Purified
Molecular Weight of Antigen	53.9 kDa

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	O15393
Gene ID (Entrez)	7113
Immunogen	This TMPRSS2 Antibody was developed against a recombinant protein corresponding to amino acids: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TMPRSS2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents