Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TMTC1 Antibody, Novus Biologicals™

TMTC1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16233520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16233520 20 μL
NBP162335 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16233520 Supplier Novus Biologicals Supplier No. NBP16233520UL

Description

Rabbit Polyclonal Antibody

TMTC1 Polyclonal specifically detects TMTC1 in Human samples. It is validated for Western Blot.

Specifications

Antigen TMTC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IUR5
Gene Alias ARG99, FLJ31400, FLJ41625, OLF, TMTC1A, transmembrane and tetratricopeptide repeat containing 1, transmembrane and tetratricopeptide repeat containing 1A, transmembrane and TPR repeat-containing protein 1
Gene Symbols TMTC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TMTC1(transmembrane and tetratricopeptide repeat containing 1) The peptide sequence was selected from the middle region of TMTC1. Peptide sequence LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV.
Molecular Weight of Antigen 87 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 83857
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.