Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMTC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | TMTC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16233520
|
Novus Biologicals
NBP16233520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP162335
|
Novus Biologicals
NBP162335 |
100 μL |
Each for $487.50
|
|
|||||
Description
TMTC1 Polyclonal specifically detects TMTC1 in Human samples. It is validated for Western Blot.Specifications
| TMTC1 | |
| Polyclonal | |
| Rabbit | |
| Q8IUR5 | |
| 83857 | |
| Synthetic peptides corresponding to TMTC1(transmembrane and tetratricopeptide repeat containing 1) The peptide sequence was selected from the middle region of TMTC1. Peptide sequence LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ARG99, FLJ31400, FLJ41625, OLF, TMTC1A, transmembrane and tetratricopeptide repeat containing 1, transmembrane and tetratricopeptide repeat containing 1A, transmembrane and TPR repeat-containing protein 1 | |
| TMTC1 | |
| IgG | |
| 87 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title