TMTC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15992920UL

Catalog No. NBP15992920

Description

TMTC4 Polyclonal specifically detects TMTC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TMTC4
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Alias: FLJ14624, FLJ22153, transmembrane and tetratricopeptide repeat containing 4, transmembrane and TPR repeat-containing protein 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84899
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: TMTC4
• Immunogen: Synthetic peptides corresponding to TMTC4(transmembrane and tetratricopeptide repeat containing 4) The peptide sequence was selected from the N terminal of TMTC4. Peptide sequence NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG