Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMTC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	TMTC4
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15992920 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15992920UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159929 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159929	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TMTC4 Polyclonal specifically detects TMTC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	TMTC4
Classification	Polyclonal
Host Species	Rabbit
Gene Alias	FLJ14624, FLJ22153, transmembrane and tetratricopeptide repeat containing 4, transmembrane and TPR repeat-containing protein 4
Gene Symbols	TMTC4
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	84899
Immunogen	Synthetic peptides corresponding to TMTC4(transmembrane and tetratricopeptide repeat containing 4) The peptide sequence was selected from the N terminal of TMTC4. Peptide sequence NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TMTC4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents