Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMTC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15992920UL
Description
TMTC4 Polyclonal specifically detects TMTC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TMTC4 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml | |
FLJ14624, FLJ22153, transmembrane and tetratricopeptide repeat containing 4, transmembrane and TPR repeat-containing protein 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
84899 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
TMTC4 | |
Synthetic peptides corresponding to TMTC4(transmembrane and tetratricopeptide repeat containing 4) The peptide sequence was selected from the N terminal of TMTC4. Peptide sequence NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF. | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction