TNIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232705

Catalog No. NBP232705

Description

TNIP1 Polyclonal specifically detects TNIP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: TNIP1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
• Gene Alias: ABIN-1, HIV-1 Nef-interacting protein, hVAN, KIAA0113nip40-1, Naf1, NAF1TNFAIP3-interacting protein 1, Nef-associated factor 1, Nef-associated factor 1 SNP, Nip40-1, TNFAIP3 interacting protein 1, VANvirion-associated nuclear-shuttling protein, Virion-associated nuclear shuttling protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TNIP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLNKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVT
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10318
• Target Species: Human
• Isotype: IgG

For Research Use Only