Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TNNI3K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17927920UL
Description
TNNI3K Polyclonal specifically detects TNNI3K in Mouse samples. It is validated for Western Blot.Specifications
TNNI3K | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_796040 | |
TNNI3K | |
The immunogen for this antibody is Tnni3k. Peptide sequence NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY. | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CARKCardiac ankyrin repeat kinase, EC 2.7.11.1, MGC142099, MGC33828, serine/threonine-protein kinase TNNI3K, TNNI3 interacting kinase, TNNI3-interacting kinase | |
Rabbit | |
Affinity Purified | |
RUO | |
51086 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction