Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TNNI3K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | TNNI3K |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17927920
|
Novus Biologicals
NBP17927920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179279
|
Novus Biologicals
NBP179279 |
100 μL |
Each for $487.50
|
|
|||||
Description
TNNI3K Polyclonal specifically detects TNNI3K in Mouse samples. It is validated for Western Blot.Specifications
| TNNI3K | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CARKCardiac ankyrin repeat kinase, EC 2.7.11.1, MGC142099, MGC33828, serine/threonine-protein kinase TNNI3K, TNNI3 interacting kinase, TNNI3-interacting kinase | |
| TNNI3K | |
| IgG |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| NP_796040 | |
| 51086 | |
| The immunogen for this antibody is Tnni3k. Peptide sequence NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title