TOM1L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18600625UL

Catalog No. NB432179

Description

TOM1L2 Polyclonal specifically detects TOM1L2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TOM1L2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FLJ21501, FLJ32746, target of myb1 (chicken) homolog-like 1, target of myb1-like 2 (chicken), Target of Myb-like protein 2, TOM1-like protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TOM1L2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEML
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 146691
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only