TOMM22 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP180671	0.1 mL

Catalog No. NBP180671 Supplier Novus Biologicals Supplier No. NBP180671

Description

Rabbit Polyclonal Antibody has been used in 3 publications

TOMM22 Polyclonal specifically detects TOMM22 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: TOMM22
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: Q9NS69
• Gene Alias: 1C9-2, hTom22, mitochondrial import receptor subunit TOM22 homolog, mitochondrial import receptor Tom22, MST065, TOM22MSTP065, Translocase of outer membrane 22 kDa subunit homolog, translocase of outer mitochondrial membrane 22 homolog (yeast)
• Gene Symbols: TOMM22
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: Membrane Trafficking and Chaperones
• Primary or Secondary: Primary
• Gene ID (Entrez): 56993
• Test Specificity: Specificity of human TOMM22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only