Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TOP2B Antibody, Novus Biologicals™
SDP

Catalog No. NBP189527 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP189527 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP189527 Supplier Novus Biologicals Supplier No. NBP189527
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 3 publications

TOP2B Polyclonal specifically detects TOP2B in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen TOP2B
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Simple Western 1:100, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunofluorescence
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias antigen MLAA-44, DNA topoisomerase 2-beta, DNA topoisomerase II beta, DNA topoisomerase II, 180 kD, DNA topoisomerase II, beta isozyme, EC 5.99.1.3, top2beta, TOPIIB, topo II beta, topoisomerase (DNA) II beta (180kD), topoisomerase (DNA) II beta 180kDa, topoisomerase II beta, topoisomerase IIb, U937 associated antigen
Gene Symbols TOP2B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7155
Test Specificity Specificity of human TOP2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.