Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TOR/mTOR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25592025UL
Description
TOR/mTOR Polyclonal specifically detects TOR/mTOR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TOR/mTOR | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
EC 2.7.11.1, FK506 binding protein 12-rapamycin associated protein 1, FK506 binding protein 12-rapamycin associated protein 2, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1FKBP12-rapamycin complex-associated protein 1, FRAP2, Mammalian target of rapamycin, Mechanistic target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), mTOR, RAFT1, rapamycin and FKBP12 target 1, rapamycin associated protein FRAP2, Rapamycin target protein 1, RAPT1FKBP-rapamycin associated protein, serine/threonine-protein kinase mTOR | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MTOR | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE | |
25 μL | |
Autophagy, Cancer, Cell Cycle and Replication, DNA Repair, Hypoxia, Macroautophagy, MAP Kinase Signaling, mTOR Pathway, Signal Transduction, Translation Control | |
2475 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction