TOR/mTOR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP255920	Novus Biologicals NBP255920	100 μL
NB394754	Novus Biologicals NBP25592025UL	25 μL

Description

TOR/mTOR Polyclonal specifically detects TOR/mTOR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TOR/mTOR
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Autophagy, Cancer, Cell Cycle and Replication, DNA Repair, Hypoxia, Macroautophagy, MAP Kinase Signaling, mTOR Pathway, Signal Transduction, Translation Control
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2475
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 2.7.11.1, FK506 binding protein 12-rapamycin associated protein 1, FK506 binding protein 12-rapamycin associated protein 2, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1FKBP12-rapamycin complex-associated protein 1, FRAP2, Mammalian target of rapamycin, Mechanistic target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), mTOR, RAFT1, rapamycin and FKBP12 target 1, rapamycin associated protein FRAP2, Rapamycin target protein 1, RAPT1FKBP-rapamycin associated protein, serine/threonine-protein kinase mTOR
• Gene Symbols: MTOR
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only