Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP169580

Torsin 1B Antibody, Novus Biologicals™
SDP

Catalog No. NBP169580 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169580 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169580 Supplier Novus Biologicals Supplier No. NBP169580
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Torsin 1B Polyclonal specifically detects Torsin 1B in Human samples. It is validated for Western Blot.

Specifications

Antigen Torsin 1B
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O14657
Gene Alias DQ1MGC4386, Torsin family 1 member B, torsin family 1, member B (torsin B), torsin-1B
Gene Symbols TOR1B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TOR1B(torsin family 1, member B (torsin B)) The peptide sequence was selected from the C terminal of TOR1B. Peptide sequence VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID (NP_055321).
Molecular Weight of Antigen 38 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27348
Test Specificity Expected to cross react based on sequence identity Guinea pig: 86%; Zebrafish: 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.