Torsin 2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160002

Catalog No. NBP160002

Description

Torsin 2A Polyclonal specifically detects Torsin 2A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Torsin 2A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ14771, MGC99558, pro salusin, prosalusin, TORP1torsin-2A, Torsin family 2 member A, torsin family 2, member A, Torsin-2A, Torsin-related protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5JU69
• Gene Symbols: TOR2A
• Immunogen: Synthetic peptides corresponding to TOR2A(torsin family 2, member A) The peptide sequence was selected from the N terminal of TOR2A. Peptide sequence GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27433
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Form: Purified