Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Torsin 2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$159.00 - $487.50
Specifications
| Antigen | Torsin 2A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16000220
|
Novus Biologicals
NBP16000220UL |
20 μL |
Each for $159.00
|
|
|||||
|
NBP160002
|
Novus Biologicals
NBP160002 |
100 μL |
Each for $487.50
|
|
|||||
Description
Torsin 2A Polyclonal specifically detects Torsin 2A in Human samples. It is validated for Western Blot.Specifications
| Torsin 2A | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ14771, MGC99558, pro salusin, prosalusin, TORP1torsin-2A, Torsin family 2 member A, torsin family 2, member A, Torsin-2A, Torsin-related protein 1 | |
| TOR2A | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q5JU69 | |
| 27433 | |
| Synthetic peptides corresponding to TOR2A(torsin family 2, member A) The peptide sequence was selected from the N terminal of TOR2A. Peptide sequence GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS. | |
| Primary | |
| 36 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title