Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Torsin 2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	Torsin 2A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16000220 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16000220UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP160002 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP160002	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Torsin 2A Polyclonal specifically detects Torsin 2A in Human samples. It is validated for Western Blot.

Specifications

Antigen	Torsin 2A
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	FLJ14771, MGC99558, pro salusin, prosalusin, TORP1torsin-2A, Torsin family 2 member A, torsin family 2, member A, Torsin-2A, Torsin-related protein 1
Gene Symbols	TOR2A
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	Q5JU69
Gene ID (Entrez)	27433
Immunogen	Synthetic peptides corresponding to TOR2A(torsin family 2, member A) The peptide sequence was selected from the N terminal of TOR2A. Peptide sequence GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS.
Primary or Secondary	Primary
Molecular Weight of Antigen	36 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Torsin 2A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents