Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Torsin 2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16000220UL
Description
Torsin 2A Polyclonal specifically detects Torsin 2A in Human samples. It is validated for Western Blot.Specifications
Torsin 2A | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q5JU69 | |
TOR2A | |
Synthetic peptides corresponding to TOR2A(torsin family 2, member A) The peptide sequence was selected from the N terminal of TOR2A. Peptide sequence GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS. | |
Protein A purified | |
RUO | |
27433 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ14771, MGC99558, pro salusin, prosalusin, TORP1torsin-2A, Torsin family 2 member A, torsin family 2, member A, Torsin-2A, Torsin-related protein 1 | |
Rabbit | |
36 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction