Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TP53TG5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158923
Description
TP53TG5 Polyclonal specifically detects TP53TG5 in Human samples. It is validated for Western Blot.Specifications
TP53TG5 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C20orf10, chromosome 20 open reading frame 10, CLG01, dJ453C12.5, TP53 target 5, TP53-inducible gene 5 protein, TP53-target gene 5 protein | |
Rabbit | |
32 kDa | |
100 μL | |
Signal Transduction | |
27296 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9Y2B4 | |
TP53TG5 | |
Synthetic peptides corresponding to C20ORF10 The peptide sequence was selected from the N terminal of C20ORF10. Peptide sequence RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN. | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Olive baboon: 100%; Sumatran orangutan: 100%; Human: 100%; Mouse: 92%; Rat: 85%; Canine: 85%;. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction