Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TP53TG5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TP53TG5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TP53TG5 Polyclonal specifically detects TP53TG5 in Human samples. It is validated for Western Blot.Specifications
TP53TG5 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
C20orf10, chromosome 20 open reading frame 10, CLG01, dJ453C12.5, TP53 target 5, TP53-inducible gene 5 protein, TP53-target gene 5 protein | |
TP53TG5 | |
IgG | |
32 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9Y2B4 | |
27296 | |
Synthetic peptides corresponding to C20ORF10 The peptide sequence was selected from the N terminal of C20ORF10. Peptide sequence RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title