Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody, Novus Biologicals™

TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody, Novus Biologicals™
SDP

Catalog No. NB435398 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB435398 25 μL
NBP257253 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB435398 Supplier Novus Biologicals Supplier No. NBP25725325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TR beta 1/NR1A2/Thyroid Hormone Receptor beta Polyclonal specifically detects TR beta 1/NR1A2/Thyroid Hormone Receptor beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen TR beta 1/NR1A2/Thyroid Hormone Receptor beta
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian)
Gene Symbols THRB
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 7068
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.