Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRA2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157457
Description
TRA2B Polyclonal specifically detects TRA2B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TRA2B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686F18120, hTRA2-beta, SFRS10, Splicing factor, arginine/serine-rich 10, splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila), SRFS10, TRA-2 beta, TRA2-beta, TRAN2B, transformer 2 beta homolog (Drosophila), transformer 2 homolog, Transformer-2 protein homolog B, transformer-2 protein homolog beta, transformer-2-beta | |
Rabbit | |
Protein A purified | |
RUO | |
6434 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
1 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
P62995 | |
TRA2B | |
Synthetic peptides corresponding to SFRS10 (splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)) The peptide sequence was selected from the middle region of SFRS10. Peptide sequence GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Zebrafish: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction