TRA2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157457

Catalog No. NBP157457

Description

TRA2B Polyclonal specifically detects TRA2B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRA2B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686F18120, hTRA2-beta, SFRS10, Splicing factor, arginine/serine-rich 10, splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila), SRFS10, TRA-2 beta, TRA2-beta, TRAN2B, transformer 2 beta homolog (Drosophila), transformer 2 homolog, Transformer-2 protein homolog B, transformer-2 protein homolog beta, transformer-2-beta
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6434
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P62995
• Gene Symbols: TRA2B
• Immunogen: Synthetic peptides corresponding to SFRS10 (splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)) The peptide sequence was selected from the middle region of SFRS10. Peptide sequence GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified