TRABD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170734

Catalog No. NBP170734

Description

TRABD Polyclonal specifically detects TRABD in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRABD
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: TRABD
• Immunogen: Synthetic peptides corresponding to PP2447 The peptide sequence was selected from the N terminal of PP2447. Peptide sequence MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Rat: 100%; Mouse: 100%; Human: 100%; Western clawed frog: 78%; Xenopus: 78%; Chicken: 78%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: LP6054, TraB domain containing, traB domain-containing protein
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80305
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG