Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRABD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | TRABD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
TRABD Polyclonal specifically detects TRABD in Human samples. It is validated for Western Blot.Specifications
TRABD | |
Polyclonal | |
Purified | |
RUO | |
80305 | |
Synthetic peptides corresponding to PP2447 The peptide sequence was selected from the N terminal of PP2447. Peptide sequence MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
LP6054, TraB domain containing, traB domain-containing protein | |
TRABD | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title