Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRACP/PAP/ACP5 Antibody, Novus Biologicals™

TRACP/PAP/ACP5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157665 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157665 100 μL
NBP15766520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP157665 Supplier Novus Biologicals Supplier No. NBP157665

Description

Rabbit Polyclonal Antibody

TRACP/PAP/ACP5 Polyclonal specifically detects TRACP/PAP/ACP5 in Human samples. It is validated for Western Blot.

Specifications

Antigen TRACP/PAP/ACP5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS & 2% Sucrose. with 0.09% Sodium Azide
Gene Accession No. P13686
Gene Alias HPAP, TRACP5a, TRACP5b, TRAP, TrATPase
Gene Symbols ACP5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACP5 (acid phosphatase 5, tartrate resistant) The peptide sequence was selected from the N terminal of ACP5)(50ug). Peptide sequence DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Phosphatase
Primary or Secondary Primary
Gene ID (Entrez) 54
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Sheep: 100%; Xenopus: 92%; Zebrafish: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.