TRAF-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233647

Catalog No. NBP233647

Description

TRAF-4 Polyclonal specifically detects TRAF-4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRAF-4
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9BUZ4
• Gene Symbols: TRAF4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI
• Quantity: 0.1 mL
• Research Discipline: Cancer, Zinc Finger
• Gene ID (Entrez): 9618
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CART1RING finger protein 83, Cysteine-rich domain associated with RING and Traf domains protein 1, Metastatic lymph node gene 62 protein, MLN 62, MLN62cysteine-rich domain associated with ring and TRAF domain, RNF83malignant 62, TNF receptor-associated factor 4, tumor necrosis receptor-associated factor 4A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only