Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRAF7 Antibody, Novus Biologicals™

TRAF7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158999 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158999 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158999 Supplier Novus Biologicals Supplier No. NBP158999
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TRAF7 Polyclonal specifically detects TRAF7 in Human samples. It is validated for Western Blot.

Specifications

Antigen TRAF7
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6Q0C0
Gene Alias DKFZp586I021, E3 ubiquitin-protein ligase TRAF7, EC 6.3.2.-, MGC7807, RFWD1RING finger protein 119, RNF119RING finger and WD repeat-containing protein 1, TNF receptor-associated factor 7ring finger and WD repeat domain 1
Gene Symbols TRAF7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TRAF7(TNF receptor-associated factor 7) The peptide sequence was selected from the N terminal of TRAF7. Peptide sequence GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 84231
Test Specificity Expected identity based on immunogen sequence: Chicken: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.