TRAILR1/TNFRSF10A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256818

Catalog No. NBP256818

Description

TRAILR1/TNFRSF10A Polyclonal specifically detects TRAILR1/TNFRSF10A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TRAILR1/TNFRSF10A
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: APO2, CD261, CD261 antigen, cytotoxic TRAIL receptor, Death receptor 4, DR4, DR4 TRAIL receptor 1, TNF-related apoptosis inducing ligand receptor 1, TNF-related apoptosis-inducing ligand receptor 1, TRAIL-R1, TRAILR-1, TRAILR1MGC9365, tumor necrosis factor receptor superfamily member 10A, tumor necrosis factor receptor superfamily, member 10a
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TNFRSF10A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer
• Gene ID (Entrez): 8797
• Target Species: Human
• Isotype: IgG

For Research Use Only