Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAILR1/TNFRSF10A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TRAILR1/TNFRSF10A |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TRAILR1/TNFRSF10A Polyclonal specifically detects TRAILR1/TNFRSF10A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TRAILR1/TNFRSF10A | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
8797 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
APO2, CD261, CD261 antigen, cytotoxic TRAIL receptor, Death receptor 4, DR4, DR4 TRAIL receptor 1, TNF-related apoptosis inducing ligand receptor 1, TNF-related apoptosis-inducing ligand receptor 1, TRAIL-R1, TRAILR-1, TRAILR1MGC9365, tumor necrosis factor receptor superfamily member 10A, tumor necrosis factor receptor superfamily, member 10a | |
TNFRSF10A | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title