Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB036077

Transducin alpha Antibody, Novus Biologicals™
SDP

Catalog No. NB036077 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB036077 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB036077 Supplier Novus Biologicals Supplier No. NBP288455
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Transducin alpha Polyclonal specifically detects Transducin alpha in Human samples. It is validated for Western Blot.

Specifications

Antigen Transducin alpha
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose
Gene Alias CSNBAD3, GBT1, GNATR, guanine nucleotide binding protein (G protein), alpha transducing activitypolypeptide 1, guanine nucleotide-binding protein G(t) subunit alpha-1, guanine nucleotide-binding protein G(T), alpha-1 subunit, rod-type transducin alpha subunit, Transducin alpha-1 chain, transducin, rod-specific
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human Transducin alpha. Peptide sequence: YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHM The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction, Vision
Primary or Secondary Primary
Gene ID (Entrez) 2779
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.