TRAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP247598

Catalog No. NBP247598

Description

TRAP1 Polyclonal specifically detects TRAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRAP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: HSP 75, HSP75TNFR-associated protein 1, HSP90Lheat shock protein 75 kDa, mitochondrial, TNF receptor-associated protein 1, TRAP-1, tumor necrosis factor type 1 receptor associated protein, Tumor necrosis factor type 1 receptor-associated protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TRAP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIREL
• Quantity: 0.1 mL
• Research Discipline: Membrane Trafficking and Chaperones, Stem Cell Markers
• Gene ID (Entrez): 10131
• Target Species: Human
• Isotype: IgG

For Research Use Only