Learn More
Description
Specifications
Specifications
| Antigen | TRAP220/MED1 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | Activator-recruited cofactor 205 kDa component, ARC205, CRSP1TRIP2, CRSP200p53 regulatory protein RB18A, DRIP230PPAR-binding protein, mediator complex subunit 1DRIP205, mediator of RNA polymerase II transcription subunit 1, PBPPPARGBP, Peroxisome proliferator-activated receptor-binding protein, PPAR binding protein, PPARBPMGC71488, PPARG binding protein, RB18ATR-interacting protein 2, Thyroid hormone receptor-associated protein complex 220 kDa component, thyroid hormone receptor-associated protein complex component TRAP220, thyroid receptor interacting protein 2, Thyroid receptor-interacting protein 2, Trap220, TRAP220TRIP-2, vitamin D receptor-interacting protein 230 kD, Vitamin D receptor-interacting protein complex component DRIP205 |
| Gene Symbols | MED1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
