Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRAP220/MED1 Antibody, Novus Biologicals™

TRAP220/MED1 Antibody, Novus Biologicals™
SDP

Catalog No. NB394166 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB394166 25 μL
NBP257045 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB394166 Supplier Novus Biologicals Supplier No. NBP25704525UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TRAP220/MED1 Polyclonal specifically detects TRAP220/MED1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen TRAP220/MED1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Activator-recruited cofactor 205 kDa component, ARC205, CRSP1TRIP2, CRSP200p53 regulatory protein RB18A, DRIP230PPAR-binding protein, mediator complex subunit 1DRIP205, mediator of RNA polymerase II transcription subunit 1, PBPPPARGBP, Peroxisome proliferator-activated receptor-binding protein, PPAR binding protein, PPARBPMGC71488, PPARG binding protein, RB18ATR-interacting protein 2, Thyroid hormone receptor-associated protein complex 220 kDa component, thyroid hormone receptor-associated protein complex component TRAP220, thyroid receptor interacting protein 2, Thyroid receptor-interacting protein 2, Trap220, TRAP220TRIP-2, vitamin D receptor-interacting protein 230 kD, Vitamin D receptor-interacting protein complex component DRIP205
Gene Symbols MED1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 5469
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.