Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRAPPC1 Antibody, Novus Biologicals™

TRAPPC1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15771520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15771520 20 μL
NBP157715 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15771520 Supplier Novus Biologicals Supplier No. NBP15771520UL

Description

Rabbit Polyclonal Antibody

TRAPPC1 Polyclonal specifically detects TRAPPC1 in Human, Rat samples. It is validated for Western Blot.

Specifications

Antigen TRAPPC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q2KMM2
Gene Alias BET5BET5 homolog, Multiple myeloma protein 2, MUM-2, MUM2melanoma ubiquitous mutated 2, trafficking protein particle complex 1, trafficking protein particle complex subunit 1
Gene Symbols TRAPPC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TRAPPC1 (trafficking protein particle complex 1) The peptide sequence was selected from the middle region of TRAPPC1)(50ug). Peptide sequence YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 58485
Test Specificity This product is specific to Subunit or Isoform: 1.
Target Species Human, Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.