Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAPPC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15771520UL
Description
TRAPPC1 Polyclonal specifically detects TRAPPC1 in Human, Rat samples. It is validated for Western Blot.Specifications
TRAPPC1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q2KMM2 | |
TRAPPC1 | |
Synthetic peptides corresponding to TRAPPC1 (trafficking protein particle complex 1) The peptide sequence was selected from the middle region of TRAPPC1)(50ug). Peptide sequence YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM. | |
20 μL | |
Primary | |
This product is specific to Subunit or Isoform: 1. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
BET5BET5 homolog, Multiple myeloma protein 2, MUM-2, MUM2melanoma ubiquitous mutated 2, trafficking protein particle complex 1, trafficking protein particle complex subunit 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
58485 | |
Human, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction