Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAPPC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | TRAPPC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15771520
![]() |
Novus Biologicals
NBP15771520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157715
![]() |
Novus Biologicals
NBP157715 |
100 μL |
Each for $487.50
|
|
|||||
Description
TRAPPC1 Polyclonal specifically detects TRAPPC1 in Human samples. It is validated for Western Blot.Specifications
TRAPPC1 | |
Polyclonal | |
Rabbit | |
Q2KMM2 | |
58485 | |
Synthetic peptides corresponding to TRAPPC1 (trafficking protein particle complex 1) The peptide sequence was selected from the middle region of TRAPPC1)(50ug). Peptide sequence YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BET5BET5 homolog, Multiple myeloma protein 2, MUM-2, MUM2melanoma ubiquitous mutated 2, trafficking protein particle complex 1, trafficking protein particle complex subunit 1 | |
TRAPPC1 | |
IgG | |
This product is specific to Subunit or Isoform: 1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title