Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRAPPC6B Antibody, Novus Biologicals™
SDP

Catalog No. NBP17073620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17073620 20 μL
NBP170736 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17073620 Supplier Novus Biologicals Supplier No. NBP17073620UL

Rabbit Polyclonal Antibody

TRAPPC6B Polyclonal specifically detects TRAPPC6B in Human samples. It is validated for Western Blot.

Specifications

Antigen TRAPPC6B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias FLJ17772, FLJ79549, TPC6, trafficking protein particle complex 6B
Gene Symbols TRAPPC6B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TRAPPC6B(trafficking protein particle complex 6B) The peptide sequence was selected from the middle region of TRAPPC6B. Peptide sequence TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 122553
Test Specificity This product is specific to Subunit or Isoform: 6B.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.